PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Pbr019903.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Rosales; Rosaceae; Maloideae; Maleae; Pyrus
Family MYB
Protein Properties Length: 279aa    MW: 32009.4 Da    PI: 9.7408
Description MYB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Pbr019903.1genomeCPETRView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding49.68.9e-161461148
                     TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
  Myb_DNA-binding  1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48
                     +g+WT+ Ed++l  ++k +G g W++I+++ g++R++k+c++rw++yl
      Pbr019903.1 14 KGAWTALEDQILTGYIKTHGEGKWRRIPKEAGLRRCGKSCRLRWLNYL 61
                     79********************************************97 PP

2Myb_DNA-binding56.75.5e-1867112148
                      TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
  Myb_DNA-binding   1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48 
                      rg+ T+eE++l+++++k+lG++ W++Ia +++ gRt++++k++w++yl
      Pbr019903.1  67 RGNITQEEEDLIIRLHKLLGNR-WSLIAGRIP-GRTDNEIKNYWNTYL 112
                      7999******************.*********.*************97 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:1.10.10.606.1E-24564IPR009057Homeodomain-like
PROSITE profilePS5129416.965961IPR017930Myb domain
SuperFamilySSF466893.56E-2911108IPR009057Homeodomain-like
SMARTSM007171.4E-121363IPR001005SANT/Myb domain
PfamPF002494.1E-141461IPR001005SANT/Myb domain
CDDcd001678.64E-91661No hitNo description
PROSITE profilePS5129427.33962116IPR017930Myb domain
Gene3DG3DSA:1.10.10.601.1E-2565116IPR009057Homeodomain-like
SMARTSM007172.9E-1766114IPR001005SANT/Myb domain
PfamPF002492.4E-1667112IPR001005SANT/Myb domain
CDDcd001675.81E-1271112No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 279 aa     Download sequence    Send to blast
MGRSPCCSKE GLKKGAWTAL EDQILTGYIK THGEGKWRRI PKEAGLRRCG KSCRLRWLNY  60
LRPDIKRGNI TQEEEDLIIR LHKLLGNRWS LIAGRIPGRT DNEIKNYWNT YLRKKVNGAE  120
TPRLLGNKVD ENNKKKKKKR RDNSEKTNPS VNKTKPRAMV KSDSFAVIRT KASRCNKVLV  180
MPDQLPDHQI NHGLLEDTTT TISEDSMLDF DVGELLVSEN NDIPDDSDFW KICQQLEDNT  240
NNGGSKNRCP SSTSLAPLLF SEEMLKDWMR DDFFNRQC*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1a5j_A2e-26121175109B-MYB
1h8a_C3e-261211625128MYB TRANSFORMING PROTEIN
Search in ModeBase
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
1134140KKKKKRR
2135140KKKKRR
3136140KKKRR
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAB8978651e-108AB897865.1 Prunus persica Peace mRNA for R2R3 Myb transcription factor, complete cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_009362675.10.0PREDICTED: transcription repressor MYB5-like
TrEMBLM5XPD91e-107M5XPD9_PRUPE; R2R3 Myb transcription factor
STRINGVIT_04s0008g01820.t013e-97(Vitis vinifera)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF3134817
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G22640.17e-62myb domain protein 3